![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
![]() | Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) ![]() |
![]() | Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
![]() | Protein Snake phospholipase A2 [48624] (35 species) |
![]() | Species Viper (Deinagkistrodon acutus) [TaxId:36307] [69122] (1 PDB entry) |
![]() | Domain d1ijlb_: 1ijl B: [66164] |
PDB Entry: 1ijl (more details), 2.6 Å
SCOP Domain Sequences for d1ijlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ijlb_ a.133.1.2 (B:) Snake phospholipase A2 {Viper (Deinagkistrodon acutus)} sliqfetlimkvvkksgmfwysaygcycgwgghgrpqdatdrccfvhdccygkvtgcdpk mdsytyseengdivcggddpckreicecdrvaadcfrdnldtynsdtywryprqdceesp epc
Timeline for d1ijlb_: