Lineage for d1ijlb_ (1ijl B:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449032Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 449033Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 449038Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 449118Protein Snake phospholipase A2 [48624] (35 species)
  7. 449308Species Viper (Deinagkistrodon acutus) [TaxId:36307] [69122] (1 PDB entry)
  8. 449310Domain d1ijlb_: 1ijl B: [66164]

Details for d1ijlb_

PDB Entry: 1ijl (more details), 2.6 Å

PDB Description: Crystal structure of acidic phospholipase A2 from deinagkistrodon acutus

SCOP Domain Sequences for d1ijlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijlb_ a.133.1.2 (B:) Snake phospholipase A2 {Viper (Deinagkistrodon acutus)}
sliqfetlimkvvkksgmfwysaygcycgwgghgrpqdatdrccfvhdccygkvtgcdpk
mdsytyseengdivcggddpckreicecdrvaadcfrdnldtynsdtywryprqdceesp
epc

SCOP Domain Coordinates for d1ijlb_:

Click to download the PDB-style file with coordinates for d1ijlb_.
(The format of our PDB-style files is described here.)

Timeline for d1ijlb_: