SCOP 1.71: Domain d1ijla_: 1ijl A:

Lineage for d1ijla_ (1ijl A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Viper (Deinagkistrodon acutus) [TaxId:36307] [69122] (1 PDB entry)

8. Domain d1ijla_: 1ijl A: [66163]

Details for d1ijla_

PDB Entry: 1ijl, 2.6 Å

PDB Description: Crystal structure of acidic phospholipase A2 from deinagkistrodon acutus

SCOP Domain Sequences for d1ijla_:

Sequence; same for both SEQRES and ATOM records:

>d1ijla_ a.133.1.2 (A:) Snake phospholipase A2 {Viper (Deinagkistrodon acutus)}
sliqfetlimkvvkksgmfwysaygcycgwgghgrpqdatdrccfvhdccygkvtgcdpk
mdsytyseengdivcggddpckreicecdrvaadcfrdnldtynsdtywryprqdceesp
epc

Timeline for d1ijla_:

• d1ijla_ first appeared in SCOP 1.59
  
• d1ijla_ appears in SCOP 1.69
  
• d1ijla_ appears in SCOP 1.73
  
• d1ijla_ appears in the current release, SCOPe 2.08