Lineage for d1ijha2 (1ijh A:319-450)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 599429Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 599430Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 599431Family d.16.1.1: GMC oxidoreductases [54374] (5 proteins)
  6. 599432Protein Cholesterol oxidase [54375] (2 species)
  7. 599436Species Streptomyces sp. [TaxId:1931] [54377] (10 PDB entries)
  8. 599443Domain d1ijha2: 1ijh A:319-450 [66162]
    Other proteins in same PDB: d1ijha1
    complexed with fad; mutant

Details for d1ijha2

PDB Entry: 1ijh (more details), 1.53 Å

PDB Description: cholesterol oxidase from streptomyces asn485leu mutant

SCOP Domain Sequences for d1ijha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijha2 d.16.1.1 (A:319-450) Cholesterol oxidase {Streptomyces sp.}
gpngnimtaranhmwnptgahqssipalgidawdnsdssvfaeiapmpagletwvslyla
itknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinkangtiyrydlfgtqlk
afaddfcyhplg

SCOP Domain Coordinates for d1ijha2:

Click to download the PDB-style file with coordinates for d1ijha2.
(The format of our PDB-style files is described here.)

Timeline for d1ijha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ijha1