Lineage for d1ijha1 (1ijh A:9-318,A:451-506)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 688694Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 688695Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (7 families) (S)
  5. 688749Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (15 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 688750Protein Cholesterol oxidase of GMC family [51914] (2 species)
  7. 688754Species Streptomyces sp. [TaxId:1931] [51916] (11 PDB entries)
  8. 688762Domain d1ijha1: 1ijh A:9-318,A:451-506 [66161]
    Other proteins in same PDB: d1ijha2
    complexed with fad; mutant

Details for d1ijha1

PDB Entry: 1ijh (more details), 1.53 Å

PDB Description: cholesterol oxidase from streptomyces asn485leu mutant
PDB Compounds: (A:) cholesterol oxidase

SCOP Domain Sequences for d1ijha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijha1 c.3.1.2 (A:9-318,A:451-506) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]}
gyvpavvigtgygaavsalrlgeagvqtlmlemgqlwnqpgpdgnifcgmlnpdkrsswf
knrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgvgggslvnggmavepkr
syfeeilprvdssemydryfpransmlrvnhidtkwfedtewykfarvsreqagkaglgt
vfvpnvydfgymqreaagevpksalateviygnnhgkqsldktylaaalgtgkvtiqtlh
qvktirqtkdggyaltveqkdtdgkllatkeiscrylflgagslgstellvrardtgtlp
nlnsevgagwXgcvlgkatddygrvagyknlyvtdgslipgsvgvlpfvtitalaernve
riikqdv

SCOP Domain Coordinates for d1ijha1:

Click to download the PDB-style file with coordinates for d1ijha1.
(The format of our PDB-style files is described here.)

Timeline for d1ijha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ijha2