Lineage for d1iiza_ (1iiz A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1632226Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1632227Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1632263Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 1632323Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 1633193Species Tasar silkworm (Antheraea mylitta) [TaxId:34739] [69627] (1 PDB entry)
    induced antibacterial protein
  8. 1633194Domain d1iiza_: 1iiz A: [66153]

Details for d1iiza_

PDB Entry: 1iiz (more details), 2.4 Å

PDB Description: Crystal Structure of the Induced Antibacterial Protein from Tasar Silkworm, Antheraea mylitta
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1iiza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iiza_ d.2.1.2 (A:) Lysozyme {Tasar silkworm (Antheraea mylitta) [TaxId: 34739]}
krftrcglvnelrkqgfdenlmrdwvclvenesarytdkianvnkngsrdyglfqindky
wcskgstpgkdcnvtcsqlltdditvastcakkiykrtkfdawsgwdnhcnhsnpdissc

SCOPe Domain Coordinates for d1iiza_:

Click to download the PDB-style file with coordinates for d1iiza_.
(The format of our PDB-style files is described here.)

Timeline for d1iiza_: