Lineage for d1iiza_ (1iiz A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2924219Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
    automatically mapped to Pfam PF00062
  6. 2924284Protein Lysozyme [53961] (15 species)
    ubiquitous in a variety of tissues and secretions
  7. 2925538Species Tasar silkworm (Antheraea mylitta) [TaxId:34739] [69627] (1 PDB entry)
    induced antibacterial protein
  8. 2925539Domain d1iiza_: 1iiz A: [66153]

Details for d1iiza_

PDB Entry: 1iiz (more details), 2.4 Å

PDB Description: Crystal Structure of the Induced Antibacterial Protein from Tasar Silkworm, Antheraea mylitta
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1iiza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iiza_ d.2.1.2 (A:) Lysozyme {Tasar silkworm (Antheraea mylitta) [TaxId: 34739]}
krftrcglvnelrkqgfdenlmrdwvclvenesarytdkianvnkngsrdyglfqindky
wcskgstpgkdcnvtcsqlltdditvastcakkiykrtkfdawsgwdnhcnhsnpdissc

SCOPe Domain Coordinates for d1iiza_:

Click to download the PDB-style file with coordinates for d1iiza_.
(The format of our PDB-style files is described here.)

Timeline for d1iiza_: