SCOPe 2.03: Domain d1ihib_: 1ihi B:

Lineage for d1ihib_ (1ihi B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (2 species)

7. Species Human (Homo sapiens), type III [TaxId:9606] [69383] (5 PDB entries)
   bile acid binding protein

8. Domain d1ihib_: 1ihi B: [66143]
   complexed with iu5, nap

Details for d1ihib_

PDB Entry: 1ihi, 3 Å

PDB Description: Crystal Structure of Human Type III 3-alpha-Hydroxysteroid Dehydrogenase/Bile Acid Binding Protein (AKR1C2) Complexed with NADP+ and Ursodeoxycholate

PDB Compounds: (B:) 3-alpha-hydroxysteroid dehydrogenase

SCOPe Domain Sequences for d1ihib_:

Sequence; same for both SEQRES and ATOM records:

>d1ihib_ c.1.7.1 (B:) 3-alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens), type III [TaxId: 9606]}
skyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeqvg
lairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpvsv
kpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkpgl
kykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvlc
alakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnrn
vryltldifagppnypfsde

Timeline for d1ihib_:

• d1ihib_ first appeared in SCOP 1.59
  
• d1ihib_ appears in SCOPe 2.02
  
• d1ihib_ appears in SCOPe 2.04
  
• d1ihib_ appears in the current release, SCOPe 2.08