Lineage for d1ihia_ (1ihi A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) 
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) 
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (6 proteins) 
Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (2 species) 
Species Human (Homo sapiens), type III [TaxId:9606] [69383] (1 PDB entry) 
Domain d1ihia_: 1ihi A: [66142]
Details for d1ihia_
PDB Entry: 1ihi (more details), 3 Å
PDB Description: Crystal Structure of Human Type III 3-alpha-Hydroxysteroid Dehydrogenase/Bile Acid Binding Protein (AKR1C2) Complexed with NADP+ and Ursodeoxycholate
SCOP Domain Sequences for d1ihia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihia_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens), type III}
skyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeqvg
lairskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpvsv
kpgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkpgl
kykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvlc
alakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnrn
vryltldifagppnypfsde
SCOP Domain Coordinates for d1ihia_:
Click to download the PDB-style file with coordinates for d1ihia_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ihia_:
- d1ihia_ is new in SCOP 1.59
- d1ihia_ appears in SCOP 1.61
- d1ihia_ appears in the current release, SCOPe 2.08
View in 3D
