SCOPe 2.04: Domain d1ih0a_: 1ih0 A:

Lineage for d1ih0a_ (1ih0 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Human (Homo sapiens), cardiac isoform [TaxId:9606] [47508] (16 PDB entries)

8. Domain d1ih0a_: 1ih0 A: [66140]
   C-domain only
   complexed with ca, emd

Details for d1ih0a_

PDB Entry: 1ih0

PDB Description: structure of the c-domain of human cardiac troponin c in complex with ca2+ sensitizer emd 57033

PDB Compounds: (A:) troponin c, slow skeletal and cardiac muscles

SCOPe Domain Sequences for d1ih0a_:

Sequence; same for both SEQRES and ATOM records:

>d1ih0a_ a.39.1.5 (A:) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]}
gkseeelsdlfrmfdknadgyidleelkimlqatgetiteddieelmkdgdknndgridy
deflefmkgve

Timeline for d1ih0a_:

• d1ih0a_ first appeared in SCOP 1.59
  
• d1ih0a_ appears in SCOPe 2.03
  
• d1ih0a_ appears in SCOPe 2.05
  
• d1ih0a_ appears in the current release, SCOPe 2.08