SCOP 1.59: Domain d1igxa2: 1igx A:32-73

Lineage for d1igxa2 (1igx A:32-73)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)

4. Superfamily g.3.11: EGF/Laminin [57196] (6 families)

5. Family g.3.11.1: EGF-type module [57197] (17 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)

7. Species Sheep (Ovis aries) [TaxId:9940] [57211] (15 PDB entries)

8. Domain d1igxa2: 1igx A:32-73 [66137]
   Other proteins in same PDB: d1igxa1

Details for d1igxa2

PDB Entry: 1igx, 3.1 Å

PDB Description: crystal structure of eicosapentanoic acid bound in the cyclooxygenase channel of prostaglandin endoperoxide h synthase-1.

SCOP Domain Sequences for d1igxa2:

Sequence; same for both SEQRES and ATOM records:

>d1igxa2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries)}
pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe

Timeline for d1igxa2:

• d1igxa2 is new in SCOP 1.59
  
• d1igxa2 appears in SCOP 1.61
  
• d1igxa2 appears in the current release, SCOPe 2.08