Class g: Small proteins [56992] (100 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species) the rest of protein is heme-linked peroxidase, all-alpha fold |
Species Sheep (Ovis aries) [TaxId:9940] [57211] (23 PDB entries) Uniprot P05979 32-584 |
Domain d1igxa2: 1igx A:32-73 [66137] Other proteins in same PDB: d1igxa1 complexed with bgc, bog, coh, epa |
PDB Entry: 1igx (more details), 3.1 Å
SCOPe Domain Sequences for d1igxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igxa2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} pvnpccyypcqhqgicvrfgldryqcdctrtgysgpnctipe
Timeline for d1igxa2: