SCOP 1.73: Domain d1ieza_: 1iez A:

Lineage for d1ieza_ (1iez A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.115: YrdC/RibB [55820] (1 superfamily)
   core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other

4. Superfamily d.115.1: YrdC/RibB [55821] (2 families)

5. Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (1 protein)
   contains one additional helix in the C-terminal extension

6. Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (4 species)

7. Species Escherichia coli [TaxId:562] [64374] (3 PDB entries)

8. Domain d1ieza_: 1iez A: [66129]

Details for d1ieza_

PDB Entry: 1iez

PDB Description: Solution Structure of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase of Riboflavin Biosynthesis

PDB Compounds: (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOP Domain Sequences for d1ieza_:

Sequence; same for both SEQRES and ATOM records:

>d1ieza_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Escherichia coli [TaxId: 562]}
mnqtllssfgtpfervenalaalregrgvmvlddedrenegdmifpaetmtveqmaltir
hgsgivclcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrittvra
aiadgakpsdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddg
tmarapeciefankhnmalvtiedlvayrqaherkas

Timeline for d1ieza_:

• d1ieza_ first appeared in SCOP 1.59
  
• d1ieza_ appears in SCOP 1.71
  
• d1ieza_ appears in SCOP 1.75
  
• d1ieza_ appears in the current release, SCOPe 2.08