Lineage for d1ieza_ (1iez A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 333513Fold d.115: YrdC/RibB [55820] (1 superfamily)
    core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other
  4. 333514Superfamily d.115.1: YrdC/RibB [55821] (2 families) (S)
  5. 333527Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (1 protein)
    contains one additional helix in the C-terminal extension
  6. 333528Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (2 species)
  7. 333529Species Escherichia coli [TaxId:562] [64374] (3 PDB entries)
  8. 333534Domain d1ieza_: 1iez A: [66129]

Details for d1ieza_

PDB Entry: 1iez (more details)

PDB Description: Solution Structure of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase of Riboflavin Biosynthesis

SCOP Domain Sequences for d1ieza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ieza_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Escherichia coli}
mnqtllssfgtpfervenalaalregrgvmvlddedrenegdmifpaetmtveqmaltir
hgsgivclcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrittvra
aiadgakpsdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddg
tmarapeciefankhnmalvtiedlvayrqaherkas

SCOP Domain Coordinates for d1ieza_:

Click to download the PDB-style file with coordinates for d1ieza_.
(The format of our PDB-style files is described here.)

Timeline for d1ieza_: