Lineage for d1ieza_ (1iez A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.115: YrdC/RibB [55820] (1 superfamily) Superfamily d.115.1: YrdC/RibB [55821] (2 families) 
Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (1 protein) Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (1 species) Species Escherichia coli [TaxId:562] [64374] (3 PDB entries) 
Domain d1ieza_: 1iez A: [66129]
Details for d1ieza_
PDB Entry: 1iez (more details)
PDB Description: Solution Structure of 3,4-Dihydroxy-2-Butanone 4-Phosphate Synthase of Riboflavin Biosynthesis
SCOP Domain Sequences for d1ieza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ieza_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Escherichia coli}
mnqtllssfgtpfervenalaalregrgvmvlddedrenegdmifpaetmtveqmaltir
hgsgivclcitedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrittvra
aiadgakpsdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddg
tmarapeciefankhnmalvtiedlvayrqaherkas
SCOP Domain Coordinates for d1ieza_:
Click to download the PDB-style file with coordinates for d1ieza_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ieza_:
- d1ieza_ is new in SCOP 1.59
- d1ieza_ appears in SCOP 1.61
- d1ieza_ appears in the current release, SCOPe 2.08
View in 3D