Lineage for d1iexa2 (1iex A:389-603)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 311051Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 311578Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain [52279] (1 family) (S)
  5. 311579Family c.23.11.1: Beta-D-glucan exohydrolase, C-terminal domain [52280] (1 protein)
  6. 311580Protein Beta-D-glucan exohydrolase, C-terminal domain [52281] (1 species)
    interdomain linker forms an additional, N-terminal strand
  7. 311581Species Barley (Hordeum vulgare) [TaxId:4513] [52282] (6 PDB entries)
  8. 311582Domain d1iexa2: 1iex A:389-603 [66128]
    Other proteins in same PDB: d1iexa1
    complexed with fuc, man, nag, tcb

Details for d1iexa2

PDB Entry: 1iex (more details), 2.2 Å

PDB Description: crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with 4i,4iii,4v-s-trithiocellohexaose

SCOP Domain Sequences for d1iexa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iexa2 c.23.11.1 (A:389-603) Beta-D-glucan exohydrolase, C-terminal domain {Barley (Hordeum vulgare)}
lvllkngktstdapllplpkkapkilvagshadnlgyqcggwtiewqgdtgrttvgttil
eavkaavdpstvvvfaenpdaefvksggfsyaivavgehpytetkgdnlnltipepglst
vqavcggvrcatvlisgrpvvvqpllaasdalvaawlpgsegqgvtdalfgdfgftgrlp
rtwfksvdqlpmnvgdahydplfrlgyglttnatk

SCOP Domain Coordinates for d1iexa2:

Click to download the PDB-style file with coordinates for d1iexa2.
(The format of our PDB-style files is described here.)

Timeline for d1iexa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iexa1