Lineage for d1iewa2 (1iew A:389-602)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) 
Superfamily c.23.11: Beta-D-glucan exohydrolase, C-terminal domain [52279] (1 family) 
Family c.23.11.1: Beta-D-glucan exohydrolase, C-terminal domain [52280] (1 protein) Protein Beta-D-glucan exohydrolase, C-terminal domain [52281] (1 species) Species Barley (Hordeum vulgare) [TaxId:4513] [52282] (5 PDB entries) 
Domain d1iewa2: 1iew A:389-602 [66126]
Other proteins in same PDB: d1iewa1
Details for d1iewa2
PDB Entry: 1iew (more details), 2.55 Å
PDB Description: crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with 2-deoxy-2-fluoro-alpha-d-glucoside
SCOP Domain Sequences for d1iewa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iewa2 c.23.11.1 (A:389-602) Beta-D-glucan exohydrolase, C-terminal domain {Barley (Hordeum vulgare)}
lvllkngktstdapllplpkkapkilvagshadnlgyqcggwtiewqgdtgrttvgttil
eavkaavdpstvvvfaenpdaefvksggfsyaivavgehpytetkgdnlnltipepglst
vqavcggvrcatvlisgrpvvvqpllaasdalvaawlpgsegqgvtdalfgdfgftgrlp
rtwfksvdqlpmnvgdahydplfrlgyglttnat
SCOP Domain Coordinates for d1iewa2:
Click to download the PDB-style file with coordinates for d1iewa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iewa2:
- d1iewa2 is new in SCOP 1.59
- d1iewa2 appears in SCOP 1.61
- d1iewa2 appears in the current release, SCOPe 2.08
View in 3D
