Lineage for d1ieva1 (1iev A:1-388)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 816706Family c.1.8.7: NagZ-like [51553] (2 proteins)
    Pfam PF00933; Glycosyl hydrolase family 3 domain
  6. 816707Protein Beta-D-glucan exohydrolase, N-terminal domain [51554] (1 species)
    interdomain linker forms an additional, N-terminal strand
  7. 816708Species Barley (Hordeum vulgare) [TaxId:4513] [51555] (9 PDB entries)
  8. 816717Domain d1ieva1: 1iev A:1-388 [66123]
    Other proteins in same PDB: d1ieva2
    complexed with fuc, ins, man, nag

Details for d1ieva1

PDB Entry: 1iev (more details), 2.8 Å

PDB Description: crystal structure of barley beta-d-glucan glucohydrolase isoenzyme exo1 in complex with cyclohexitol
PDB Compounds: (A:) beta-d-glucan glucohydrolase isoenzyme exo1

SCOP Domain Sequences for d1ieva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ieva1 c.1.8.7 (A:1-388) Beta-D-glucan exohydrolase, N-terminal domain {Barley (Hordeum vulgare) [TaxId: 4513]}
dyvlykdatkpvedrvadllgrmtlaekigqmtqierlvatpdvlrdnfigsllsgggsv
prkgatakewqdmvdgfqkacmstrlgipmiygidavhgqnnvygatifphnvglgatrd
pylvkrigeatalevratgiqyafapciavcrdprwgrcyesysedrrivqsmtelipgl
qgdvpkdftsgmpfvagknkvaacakhfvgdggtvdginenntiinreglmnihmpaykn
amdkgvstvmisysswngvkmhanqdlvtgylkdtlkfkgfvisdwegidrittpagsdy
sysvkasilagldmimvpnkyqqfisiltghvnggvipmsriddavtrilrvkftmglfe
npyadpamaeqlgkqehrdlareaarks

SCOP Domain Coordinates for d1ieva1:

Click to download the PDB-style file with coordinates for d1ieva1.
(The format of our PDB-style files is described here.)

Timeline for d1ieva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ieva2