Lineage for d1ie0a_ (1ie0 A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) 
Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (1 protein) Protein Autoinducer-2 production protein LuxS [64295] (4 species) Species Bacillus subtilis [TaxId:1423] [64296] (4 PDB entries) 
Domain d1ie0a_: 1ie0 A: [66120]
Details for d1ie0a_
PDB Entry: 1ie0 (more details), 1.6 Å
PDB Description: crystal structure of luxs
SCOP Domain Sequences for d1ie0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ie0a_ d.185.1.2 (A:) Autoinducer-2 production protein LuxS {Bacillus subtilis}
psvesfeldhnavvapyvrhcgvhkvgtdgvvnkfdirfcqpnkqamkpdtihtlehlla
ftirshaekydhfdiidispmgcqtgyylvvsgeptsaeivdlledtmkeaveiteipaa
nekqcgqaklhdlegakrlmrfwlsqdkeellkvfg
SCOP Domain Coordinates for d1ie0a_:
Click to download the PDB-style file with coordinates for d1ie0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ie0a_:
- d1ie0a_ is new in SCOP 1.59
- d1ie0a_ appears in SCOP 1.61
- d1ie0a_ appears in the current release, SCOPe 2.08
View in 3D