SCOPe 2.05: Domain d1ibsa2: 1ibs A:167-315

Lineage for d1ibsa2 (1ibs A:167-315)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.2: Phosphoribosylpyrophosphate synthetase-like [53296] (2 proteins)
   duplication: consists of two domains of this fold

6. Protein Phosphoribosylpyrophosphate synthetase [53297] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [53298] (3 PDB entries)

8. Domain d1ibsa2: 1ibs A:167-315 [66108]
   complexed with abm, cd, so4

Details for d1ibsa2

PDB Entry: 1ibs, 2.8 Å

PDB Description: phosphoribosyldiphosphate synthetase in complex with cadmium ions

PDB Compounds: (A:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d1ibsa2:

Sequence, based on SEQRES records:

>d1ibsa2 c.61.1.2 (A:167-315) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]}
divivspdhggvtrarkladrlkapiaiidkrrprpnvaevmnivgniegktailiddii
dtagtitlaanalvengakevyaccthpvlsgpaverinnstikelvvtnsiklpeekki
erfkqlsvgpllaeaiirvheqqsvsylf

Sequence, based on observed residues (ATOM records):

>d1ibsa2 c.61.1.2 (A:167-315) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]}
divivspdhggvtrarkladrlkapiaiidkrmnivgniegktailiddiidtagtitla
analvengakevyaccthpvlsgpaverinnstikelvvtnsiklpeekkierfkqlsvg
pllaeaiirvheqqsvsylf

Timeline for d1ibsa2:

• d1ibsa2 first appeared in SCOP 1.59
  
• d1ibsa2 appears in SCOPe 2.04
  
• d1ibsa2 appears in SCOPe 2.06
  
• d1ibsa2 appears in the current release, SCOPe 2.08