Lineage for d1ib0a2 (1ib0 A:154-300)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2467994Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2467995Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2467996Family c.25.1.1: Reductases [52344] (5 proteins)
  6. 2467997Protein cytochrome b5 reductase [52357] (3 species)
  7. 2468000Species Norway rat (Rattus norvegicus) [TaxId:10116] [69450] (3 PDB entries)
    Uniprot P20070 33-300
  8. 2468004Domain d1ib0a2: 1ib0 A:154-300 [66106]
    Other proteins in same PDB: d1ib0a1, d1ib0a3
    complexed with fad, nad

Details for d1ib0a2

PDB Entry: 1ib0 (more details), 2.3 Å

PDB Description: crystal structure of rat b5r in complex with fad and nad
PDB Compounds: (A:) nadh-cytochrome b5 reductase

SCOPe Domain Sequences for d1ib0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ib0a2 c.25.1.1 (A:154-300) cytochrome b5 reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gkfairadkksnpvvrtvksvgmiaggtgitpmlqviravlkdpndhtvcyllfanqsek
dillrpeleelrnehssrfklwytvdkapdawdysqgfvneemirdhlpppgeetlilmc
gpppmiqfaclpnlervghpkercftf

SCOPe Domain Coordinates for d1ib0a2:

Click to download the PDB-style file with coordinates for d1ib0a2.
(The format of our PDB-style files is described here.)

Timeline for d1ib0a2: