Lineage for d1ib0a1 (1ib0 A:29-153)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669479Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669704Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 669726Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 669731Protein cytochrome b5 reductase [50427] (3 species)
  7. 669736Species Rat (Rattus norvegicus) [TaxId:10116] [69273] (3 PDB entries)
  8. 669740Domain d1ib0a1: 1ib0 A:29-153 [66105]
    Other proteins in same PDB: d1ib0a2
    complexed with fad, nad

Details for d1ib0a1

PDB Entry: 1ib0 (more details), 2.3 Å

PDB Description: crystal structure of rat b5r in complex with fad and nad
PDB Compounds: (A:) nadh-cytochrome b5 reductase

SCOP Domain Sequences for d1ib0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ib0a1 b.43.4.2 (A:29-153) cytochrome b5 reductase {Rat (Rattus norvegicus) [TaxId: 10116]}
hhhmitlenpdikyplrlidkeilshdtrrfrfalpspqhilglpigqhiylstridgnl
virpytpvssdddkgfvdlvvkvyfkethpkfpaggkmsqylenmnigdtiefrgpngll
vyqgk

SCOP Domain Coordinates for d1ib0a1:

Click to download the PDB-style file with coordinates for d1ib0a1.
(The format of our PDB-style files is described here.)

Timeline for d1ib0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ib0a2