Class b: All beta proteins [48724] (165 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein cytochrome b5 reductase [50427] (3 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [69273] (3 PDB entries) |
Domain d1ib0a1: 1ib0 A:29-153 [66105] Other proteins in same PDB: d1ib0a2 complexed with fad, nad |
PDB Entry: 1ib0 (more details), 2.3 Å
SCOP Domain Sequences for d1ib0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ib0a1 b.43.4.2 (A:29-153) cytochrome b5 reductase {Rat (Rattus norvegicus) [TaxId: 10116]} hhhmitlenpdikyplrlidkeilshdtrrfrfalpspqhilglpigqhiylstridgnl virpytpvssdddkgfvdlvvkvyfkethpkfpaggkmsqylenmnigdtiefrgpngll vyqgk
Timeline for d1ib0a1: