Lineage for d1ib0a1 (1ib0 A:29-153)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies) Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) 
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (8 proteins) 
Protein cytochrome b5 reductase [50427] (2 species) Species Rat (Rattus norvegicus) [TaxId:10116] [69273] (2 PDB entries) 
Domain d1ib0a1: 1ib0 A:29-153 [66105]
Other proteins in same PDB: d1ib0a2
Details for d1ib0a1
PDB Entry: 1ib0 (more details), 2.3 Å
PDB Description: crystal structure of rat b5r in complex with fad and nad
SCOP Domain Sequences for d1ib0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ib0a1 b.43.4.2 (A:29-153) cytochrome b5 reductase {Rat (Rattus norvegicus)}
hhhmitlenpdikyplrlidkeilshdtrrfrfalpspqhilglpigqhiylstridgnl
virpytpvssdddkgfvdlvvkvyfkethpkfpaggkmsqylenmnigdtiefrgpngll
vyqgk
SCOP Domain Coordinates for d1ib0a1:
Click to download the PDB-style file with coordinates for d1ib0a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ib0a1:
- d1ib0a1 first appeared in SCOP 1.59
- d1ib0a1 appears in SCOP 1.63
- d1ib0a1 appears in the current release, SCOPe 2.08
View in 3D
