Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein cytochrome b5 reductase [50427] (3 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [69273] (3 PDB entries) Uniprot P20070 33-300 |
Domain d1ib0a1: 1ib0 A:33-153 [66105] Other proteins in same PDB: d1ib0a2, d1ib0a3 complexed with fad, nad |
PDB Entry: 1ib0 (more details), 2.3 Å
SCOPe Domain Sequences for d1ib0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ib0a1 b.43.4.2 (A:33-153) cytochrome b5 reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]} itlenpdikyplrlidkeilshdtrrfrfalpspqhilglpigqhiylstridgnlvirp ytpvssdddkgfvdlvvkvyfkethpkfpaggkmsqylenmnigdtiefrgpngllvyqg k
Timeline for d1ib0a1: