Lineage for d1i8tb2 (1i8t B:245-313)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935244Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2935245Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2935673Family d.16.1.7: UDP-galactopyranose mutase [69670] (1 protein)
  6. 2935674Protein UDP-galactopyranose mutase [69671] (2 species)
  7. 2935675Species Escherichia coli [TaxId:562] [69672] (1 PDB entry)
  8. 2935677Domain d1i8tb2: 1i8t B:245-313 [66097]
    Other proteins in same PDB: d1i8ta1, d1i8tb1
    complexed with fad

Details for d1i8tb2

PDB Entry: 1i8t (more details), 2.4 Å

PDB Description: structure of udp-galactopyranose mutase from e.coli
PDB Compounds: (B:) udp-galactopyranose mutase

SCOPe Domain Sequences for d1i8tb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8tb2 d.16.1.7 (B:245-313) UDP-galactopyranose mutase {Escherichia coli [TaxId: 562]}
eyrslkfeterhefpnfqgnavinftdanvpytriiehkhfdyvetkhtvvtkeyplewk
vgdepyypv

SCOPe Domain Coordinates for d1i8tb2:

Click to download the PDB-style file with coordinates for d1i8tb2.
(The format of our PDB-style files is described here.)

Timeline for d1i8tb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i8tb1