Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.7: UDP-galactopyranose mutase [69670] (1 protein) |
Protein UDP-galactopyranose mutase [69671] (2 species) |
Species Escherichia coli [TaxId:562] [69672] (1 PDB entry) |
Domain d1i8tb2: 1i8t B:245-313 [66097] Other proteins in same PDB: d1i8ta1, d1i8tb1 complexed with fad |
PDB Entry: 1i8t (more details), 2.4 Å
SCOPe Domain Sequences for d1i8tb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i8tb2 d.16.1.7 (B:245-313) UDP-galactopyranose mutase {Escherichia coli [TaxId: 562]} eyrslkfeterhefpnfqgnavinftdanvpytriiehkhfdyvetkhtvvtkeyplewk vgdepyypv
Timeline for d1i8tb2: