SCOP 1.69: Domain d1i8tb1: 1i8t B:1-244,B:314-367

Lineage for d1i8tb1 (1i8t B:1-244,B:314-367)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families)
   this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains

5. Family c.4.1.3: UDP-galactopyranose mutase, N-terminal domain [69427] (1 protein)
   domain structure is similar to that of D-aminoacid oxidase

6. Protein UDP-galactopyranose mutase, N-terminal domain [69428] (1 species)

7. Species Escherichia coli [TaxId:562] [69429] (1 PDB entry)

8. Domain d1i8tb1: 1i8t B:1-244,B:314-367 [66096]
   Other proteins in same PDB: d1i8ta2, d1i8tb2

Details for d1i8tb1

PDB Entry: 1i8t, 2.4 Å

PDB Description: structure of udp-galactopyranose mutase from e.coli

SCOP Domain Sequences for d1i8tb1:

Sequence; same for both SEQRES and ATOM records:

>d1i8tb1 c.4.1.3 (B:1-244,B:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli}
mydyiivgsglfgavcanelkklnkkvlviekrnhiggnaytedcegiqihkygahifht
ndkyiwdyvndlvefnrftnsplaiykdklfnlpfnmntfhqmwgvkdpqeaqniinaqk
kkygdkvpenleeqaislvgedlyqalikgytekqwgrsakelpafiikripvrftfdnn
yfsdryqgipvggytkliekmlegvdvklgidflkdkdslaskahriiytgpidqyfdyr
fgalXndnknmelfkkyrelasredkvifggrlaeykyydmhqvisaalyqvknimstd

Timeline for d1i8tb1:

• d1i8tb1 first appeared in SCOP 1.59
  
• d1i8tb1 appears in SCOP 1.67
  
• d1i8tb1 appears in SCOP 1.71
  
• d1i8tb1 appears in the current release, SCOPe 2.08