Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.4: Nucleotide-binding domain [51970] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like |
Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains |
Family c.4.1.3: UDP-galactopyranose mutase, N-terminal domain [69427] (1 protein) domain structure is similar to that of D-aminoacid oxidase |
Protein UDP-galactopyranose mutase, N-terminal domain [69428] (2 species) |
Species Escherichia coli [TaxId:562] [69429] (1 PDB entry) |
Domain d1i8ta1: 1i8t A:1-244,A:314-367 [66094] Other proteins in same PDB: d1i8ta2, d1i8tb2 complexed with fad |
PDB Entry: 1i8t (more details), 2.4 Å
SCOPe Domain Sequences for d1i8ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} mydyiivgsglfgavcanelkklnkkvlviekrnhiggnaytedcegiqihkygahifht ndkyiwdyvndlvefnrftnsplaiykdklfnlpfnmntfhqmwgvkdpqeaqniinaqk kkygdkvpenleeqaislvgedlyqalikgytekqwgrsakelpafiikripvrftfdnn yfsdryqgipvggytkliekmlegvdvklgidflkdkdslaskahriiytgpidqyfdyr fgalXndnknmelfkkyrelasredkvifggrlaeykyydmhqvisaalyqvknimstd
Timeline for d1i8ta1: