Lineage for d1i8ta1 (1i8t A:1-244,A:314-367)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097360Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2097361Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 2097455Family c.4.1.3: UDP-galactopyranose mutase, N-terminal domain [69427] (1 protein)
    domain structure is similar to that of D-aminoacid oxidase
  6. 2097456Protein UDP-galactopyranose mutase, N-terminal domain [69428] (2 species)
  7. 2097457Species Escherichia coli [TaxId:562] [69429] (1 PDB entry)
  8. 2097458Domain d1i8ta1: 1i8t A:1-244,A:314-367 [66094]
    Other proteins in same PDB: d1i8ta2, d1i8tb2
    complexed with fad

Details for d1i8ta1

PDB Entry: 1i8t (more details), 2.4 Å

PDB Description: strcuture of udp-galactopyranose mutase from e.coli
PDB Compounds: (A:) udp-galactopyranose mutase

SCOPe Domain Sequences for d1i8ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]}
mydyiivgsglfgavcanelkklnkkvlviekrnhiggnaytedcegiqihkygahifht
ndkyiwdyvndlvefnrftnsplaiykdklfnlpfnmntfhqmwgvkdpqeaqniinaqk
kkygdkvpenleeqaislvgedlyqalikgytekqwgrsakelpafiikripvrftfdnn
yfsdryqgipvggytkliekmlegvdvklgidflkdkdslaskahriiytgpidqyfdyr
fgalXndnknmelfkkyrelasredkvifggrlaeykyydmhqvisaalyqvknimstd

SCOPe Domain Coordinates for d1i8ta1:

Click to download the PDB-style file with coordinates for d1i8ta1.
(The format of our PDB-style files is described here.)

Timeline for d1i8ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i8ta2