Lineage for d1i8qa4 (1i8q A:620-911)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309061Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 1309200Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 1309343Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins)
    automatically mapped to Pfam PF02278
  6. 1309361Protein Hyaluronate lyase [50009] (2 species)
  7. 1309382Species Streptococcus agalactiae [TaxId:1311] [69241] (3 PDB entries)
  8. 1309384Domain d1i8qa4: 1i8q A:620-911 [66093]
    Other proteins in same PDB: d1i8qa1, d1i8qa2, d1i8qa3

Details for d1i8qa4

PDB Entry: 1i8q (more details), 2.2 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase complexed with enzyme product, unsaturated disaccharide hyaluronan
PDB Compounds: (A:) hyaluronate lyase

SCOPe Domain Sequences for d1i8qa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8qa4 b.30.5.2 (A:620-911) Hyaluronate lyase {Streptococcus agalactiae [TaxId: 1311]}
lksnlstfnsmdrlayynakkdfgfalslhskrtlnyegmndentrgwytgdgmfyiyns
dqshysnhfwptvnpykmagttekdakredttkefmskhskdakektgqvtgtsdfvgsv
klndhfalaamdftnwdrtltaqkgwvilndkivflgsnikntngignvsttidqrkdds
ktpyttyvngktidlkqassqqftdtksvfleskepgrnigyiffknstidierkeqtgt
wnsinrtskntsivsnpfitisqkhdnkgdsygymmvpnidrtsfdklansk

SCOPe Domain Coordinates for d1i8qa4:

Click to download the PDB-style file with coordinates for d1i8qa4.
(The format of our PDB-style files is described here.)

Timeline for d1i8qa4: