Lineage for d1i8qa4 (1i8q A:620-919)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109071Fold b.30: Supersandwich [49993] (4 superfamilies)
  4. 109241Superfamily b.30.3: Hyaluronate lyase-like, central domain [50005] (1 family) (S)
  5. 109242Family b.30.3.1: Hyaluronate lyase-like, central domain [50006] (2 proteins)
  6. 109250Protein Hyaluronate lyase [50009] (2 species)
  7. 109251Species Streptococcus agalactiae [TaxId:1311] [69241] (2 PDB entries)
  8. 109253Domain d1i8qa4: 1i8q A:620-919 [66093]
    Other proteins in same PDB: d1i8qa1, d1i8qa2, d1i8qa3

Details for d1i8qa4

PDB Entry: 1i8q (more details), 2.2 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase complexed with enzyme product, unsaturated disaccharide hyaluronan

SCOP Domain Sequences for d1i8qa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8qa4 b.30.3.1 (A:620-919) Hyaluronate lyase {Streptococcus agalactiae}
lksnlstfnsmdrlayynakkdfgfalslhskrtlnyegmndentrgwytgdgmfyiyns
dqshysnhfwptvnpykmagttekdakredttkefmskhskdakektgqvtgtsdfvgsv
klndhfalaamdftnwdrtltaqkgwvilndkivflgsnikntngignvsttidqrkdds
ktpyttyvngktidlkqassqqftdtksvfleskepgrnigyiffknstidierkeqtgt
wnsinrtskntsivsnpfitisqkhdnkgdsygymmvpnidrtsfdklanskevellens

SCOP Domain Coordinates for d1i8qa4:

Click to download the PDB-style file with coordinates for d1i8qa4.
(The format of our PDB-style files is described here.)

Timeline for d1i8qa4: