Lineage for d1i8qa3 (1i8q A:920-984)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226400Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
    sandwich, 10 strands in 2 sheets; "folded meander"
  4. 226401Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 226402Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (2 proteins)
  6. 226410Protein Hyaluronate lyase [49867] (2 species)
  7. 226411Species Streptococcus agalactiae [TaxId:1311] [69232] (3 PDB entries)
  8. 226413Domain d1i8qa3: 1i8q A:920-984 [66092]
    Other proteins in same PDB: d1i8qa1, d1i8qa2, d1i8qa4
    complexed with gc4, nag

Details for d1i8qa3

PDB Entry: 1i8q (more details), 2.2 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase complexed with enzyme product, unsaturated disaccharide hyaluronan

SCOP Domain Sequences for d1i8qa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8qa3 b.24.1.1 (A:920-984) Hyaluronate lyase {Streptococcus agalactiae}
skqqviydknsqtwavikhdnqeslinnqfkmnkaglylvqkvgndyqnvyyqpqtmtkt
dqlai

SCOP Domain Coordinates for d1i8qa3:

Click to download the PDB-style file with coordinates for d1i8qa3.
(The format of our PDB-style files is described here.)

Timeline for d1i8qa3: