Lineage for d1i8qa3 (1i8q A:920-984)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily) Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) 
Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (2 proteins) Protein Hyaluronate lyase [49867] (2 species) 
Species Streptococcus agalactiae [TaxId:1311] [69232] (2 PDB entries) 
Domain d1i8qa3: 1i8q A:920-984 [66092]
Other proteins in same PDB: d1i8qa1, d1i8qa2, d1i8qa4
Details for d1i8qa3
PDB Entry: 1i8q (more details), 2.2 Å
PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase complexed with enzyme product, unsaturated disaccharide hyaluronan
SCOP Domain Sequences for d1i8qa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i8qa3 b.24.1.1 (A:920-984) Hyaluronate lyase {Streptococcus agalactiae}
skqqviydknsqtwavikhdnqeslinnqfkmnkaglylvqkvgndyqnvyyqpqtmtkt
dqlai
SCOP Domain Coordinates for d1i8qa3:
Click to download the PDB-style file with coordinates for d1i8qa3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i8qa3:
- d1i8qa3 first appeared in SCOP 1.59
- d1i8qa3 appears in SCOP 1.63
- d1i8qa3 appears in the current release, SCOPe 2.08
View in 3D
