Lineage for d1i8qa3 (1i8q A:920-984)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 108399Fold b.24: Hyaluronate lyase-like, C-terminal domain [49862] (1 superfamily)
  4. 108400Superfamily b.24.1: Hyaluronate lyase-like, C-terminal domain [49863] (1 family) (S)
  5. 108401Family b.24.1.1: Hyaluronate lyase-like, C-terminal domain [49864] (2 proteins)
  6. 108409Protein Hyaluronate lyase [49867] (2 species)
  7. 108410Species Streptococcus agalactiae [TaxId:1311] [69232] (2 PDB entries)
  8. 108412Domain d1i8qa3: 1i8q A:920-984 [66092]
    Other proteins in same PDB: d1i8qa1, d1i8qa2, d1i8qa4

Details for d1i8qa3

PDB Entry: 1i8q (more details), 2.2 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase complexed with enzyme product, unsaturated disaccharide hyaluronan
PDB Compounds: (A:)

SCOP Domain Sequences for d1i8qa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8qa3 b.24.1.1 (A:920-984) Hyaluronate lyase {Streptococcus agalactiae}
skqqviydknsqtwavikhdnqeslinnqfkmnkaglylvqkvgndyqnvyyqpqtmtkt
dqlai

SCOP Domain Coordinates for d1i8qa3:

Click to download the PDB-style file with coordinates for d1i8qa3.
(The format of our PDB-style files is described here.)

Timeline for d1i8qa3: