Lineage for d1i8qa2 (1i8q A:171-248)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291481Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 291541Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 291630Protein Hyaluronate lyase precatalytic domain [69167] (1 species)
    precedes the catalytic incomplete alpha5/alpha5 barrel
    a rudiment form of Ig-like domain
  7. 291631Species Streptococcus agalactiae [TaxId:1311] [69168] (3 PDB entries)
  8. 291633Domain d1i8qa2: 1i8q A:171-248 [66091]
    Other proteins in same PDB: d1i8qa1, d1i8qa3, d1i8qa4
    complexed with gc4, nag

Details for d1i8qa2

PDB Entry: 1i8q (more details), 2.2 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase complexed with enzyme product, unsaturated disaccharide hyaluronan

SCOP Domain Sequences for d1i8qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8qa2 b.1.18.2 (A:171-248) Hyaluronate lyase precatalytic domain {Streptococcus agalactiae}
sehpqpvttqieksvntalnknyvfnkadyqytltnpslgkivggilypnatgsttvkis
dksgkiikevplsvtast

SCOP Domain Coordinates for d1i8qa2:

Click to download the PDB-style file with coordinates for d1i8qa2.
(The format of our PDB-style files is described here.)

Timeline for d1i8qa2: