SCOP 1.65: Domain d1i8qa2: 1i8q A:171-248

Lineage for d1i8qa2 (1i8q A:171-248)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (13 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Hyaluronate lyase precatalytic domain [69167] (1 species)
   precedes the catalytic incomplete alpha5/alpha5 barrel
   a rudiment form of Ig-like domain

7. Species Streptococcus agalactiae [TaxId:1311] [69168] (3 PDB entries)

8. Domain d1i8qa2: 1i8q A:171-248 [66091]
   Other proteins in same PDB: d1i8qa1, d1i8qa3, d1i8qa4
   complexed with gc4, nag

Details for d1i8qa2

PDB Entry: 1i8q, 2.2 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase complexed with enzyme product, unsaturated disaccharide hyaluronan

SCOP Domain Sequences for d1i8qa2:

Sequence; same for both SEQRES and ATOM records:

>d1i8qa2 b.1.18.2 (A:171-248) Hyaluronate lyase precatalytic domain {Streptococcus agalactiae}
sehpqpvttqieksvntalnknyvfnkadyqytltnpslgkivggilypnatgsttvkis
dksgkiikevplsvtast

Timeline for d1i8qa2:

• d1i8qa2 first appeared in SCOP 1.59
  
• d1i8qa2 appears in SCOP 1.63
  
• d1i8qa2 appears in SCOP 1.67
  
• d1i8qa2 appears in the current release, SCOPe 2.08