Lineage for d1i8qa1 (1i8q A:249-619)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 645795Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 645968Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
    incomplete toroid
  5. 645974Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (4 proteins)
  6. 645992Protein Hyaluronate lyase [48237] (2 species)
  7. 645993Species Streptococcus agalactiae [TaxId:1311] [69089] (3 PDB entries)
    preceded by a small all-beta Ig-like domain
  8. 645995Domain d1i8qa1: 1i8q A:249-619 [66090]
    Other proteins in same PDB: d1i8qa2, d1i8qa3, d1i8qa4
    complexed with gc4, nag

Details for d1i8qa1

PDB Entry: 1i8q (more details), 2.2 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase complexed with enzyme product, unsaturated disaccharide hyaluronan
PDB Compounds: (A:) hyaluronate lyase

SCOP Domain Sequences for d1i8qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8qa1 a.102.3.2 (A:249-619) Hyaluronate lyase {Streptococcus agalactiae [TaxId: 1311]}
ednftklldkwndvtignyvydtndsnmqklnqkldetnaknieaikldsnrtflwkdld
nlnnsaqltatyrrledlakqitnphstiyknekairtvkeslawlhqnfynvnkdiegs
anwwdfeigvprsitgtlslmnnyftdaeiktytdpiehfvpdaeyfrktlvnpfkalgg
nlvdmgrvkiiegllrkdntiiektshslknlfttatkaegfyadgsyidhtnvaytgay
gnvlidgltqllpiiqetdykisnqeldmvykwinqsflplivkgelmdmsrgrsisrea
asshaaavevlrgflrlanmsneernldlkstiktiitsnkfynvfnnlksysdianmnk
llndstvatkp

SCOP Domain Coordinates for d1i8qa1:

Click to download the PDB-style file with coordinates for d1i8qa1.
(The format of our PDB-style files is described here.)

Timeline for d1i8qa1: