Lineage for d1i8qa1 (1i8q A:249-619)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.102: alpha/alpha toroid [48207] (4 superfamilies) 
Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) 
Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (2 proteins) Protein Hyaluronate lyase [48237] (2 species) 
Species Streptococcus agalactiae [TaxId:1311] [69089] (2 PDB entries) 
Domain d1i8qa1: 1i8q A:249-619 [66090]
Other proteins in same PDB: d1i8qa2, d1i8qa3, d1i8qa4
Details for d1i8qa1
PDB Entry: 1i8q (more details), 2.2 Å
PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase complexed with enzyme product, unsaturated disaccharide hyaluronan
PDB Compounds: (A:) SCOP Domain Sequences for d1i8qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i8qa1 a.102.3.2 (A:249-619) Hyaluronate lyase {Streptococcus agalactiae}
ednftklldkwndvtignyvydtndsnmqklnqkldetnaknieaikldsnrtflwkdld
nlnnsaqltatyrrledlakqitnphstiyknekairtvkeslawlhqnfynvnkdiegs
anwwdfeigvprsitgtlslmnnyftdaeiktytdpiehfvpdaeyfrktlvnpfkalgg
nlvdmgrvkiiegllrkdntiiektshslknlfttatkaegfyadgsyidhtnvaytgay
gnvlidgltqllpiiqetdykisnqeldmvykwinqsflplivkgelmdmsrgrsisrea
asshaaavevlrgflrlanmsneernldlkstiktiitsnkfynvfnnlksysdianmnk
llndstvatkp
SCOP Domain Coordinates for d1i8qa1:
Click to download the PDB-style file with coordinates for d1i8qa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i8qa1:
- d1i8qa1 appears in SCOP 1.61
- d1i8qa1 appears in the current release, SCOPe 2.07
View in 3D
