Lineage for d1i8qa1 (1i8q A:249-619)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100027Fold a.102: alpha/alpha toroid [48207] (4 superfamilies)
  4. 100096Superfamily a.102.3: Chondroitin AC/alginate lyase [48230] (2 families) (S)
  5. 100102Family a.102.3.2: Hyaluronate lyase-like catalytic, N-terminal domain [48234] (2 proteins)
  6. 100110Protein Hyaluronate lyase [48237] (2 species)
  7. 100111Species Streptococcus agalactiae [TaxId:1311] [69089] (2 PDB entries)
  8. 100113Domain d1i8qa1: 1i8q A:249-619 [66090]
    Other proteins in same PDB: d1i8qa2, d1i8qa3, d1i8qa4

Details for d1i8qa1

PDB Entry: 1i8q (more details), 2.2 Å

PDB Description: crystal structure of streptococcus agalactiae hyaluronate lyase complexed with enzyme product, unsaturated disaccharide hyaluronan
PDB Compounds: (A:)

SCOP Domain Sequences for d1i8qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8qa1 a.102.3.2 (A:249-619) Hyaluronate lyase {Streptococcus agalactiae}
ednftklldkwndvtignyvydtndsnmqklnqkldetnaknieaikldsnrtflwkdld
nlnnsaqltatyrrledlakqitnphstiyknekairtvkeslawlhqnfynvnkdiegs
anwwdfeigvprsitgtlslmnnyftdaeiktytdpiehfvpdaeyfrktlvnpfkalgg
nlvdmgrvkiiegllrkdntiiektshslknlfttatkaegfyadgsyidhtnvaytgay
gnvlidgltqllpiiqetdykisnqeldmvykwinqsflplivkgelmdmsrgrsisrea
asshaaavevlrgflrlanmsneernldlkstiktiitsnkfynvfnnlksysdianmnk
llndstvatkp

SCOP Domain Coordinates for d1i8qa1:

Click to download the PDB-style file with coordinates for d1i8qa1.
(The format of our PDB-style files is described here.)

Timeline for d1i8qa1: