![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
![]() | Species Anti ssDNA Fab, (mouse), kappa L chain [69142] (1 PDB entry) |
![]() | Domain d1i8ml1: 1i8m L:1-107 [66088] Other proteins in same PDB: d1i8ma2, d1i8mb2, d1i8mh2, d1i8ml2 |
PDB Entry: 1i8m (more details), 2.1 Å
SCOP Domain Sequences for d1i8ml1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i8ml1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Anti ssDNA Fab, (mouse), kappa L chain} elqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps rfsgsgsgtqfslkinslqpedfgsyycqhhygtpltfgagtklelk
Timeline for d1i8ml1: