| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
| Species Anti-ssDNA Fab, (mouse), kappa L chain [69153] (1 PDB entry) |
| Domain d1i8mh2: 1i8m H:114-213 [66087] Other proteins in same PDB: d1i8ma1, d1i8mb1, d1i8mh1, d1i8ml1 |
PDB Entry: 1i8m (more details), 2.1 Å
SCOP Domain Sequences for d1i8mh2:
Sequence, based on SEQRES records: (download)
>d1i8mh2 b.1.1.2 (H:114-213) Immunoglobulin (constant domains of L and H chains) {Anti-ssDNA Fab, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
>d1i8mh2 b.1.1.2 (H:114-213) Immunoglobulin (constant domains of L and H chains) {Anti-ssDNA Fab, (mouse), kappa L chain}
akttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
vtvpsstwpsetvtcnvahpasstkvdkkivpr
Timeline for d1i8mh2: