Lineage for d1i8mh2 (1i8m H:114-213)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159243Species Anti ssDNA Fab, (mouse), kappa L chain [69153] (1 PDB entry)
  8. 159246Domain d1i8mh2: 1i8m H:114-213 [66087]
    Other proteins in same PDB: d1i8ma1, d1i8mb1, d1i8mh1, d1i8ml1

Details for d1i8mh2

PDB Entry: 1i8m (more details), 2.1 Å

PDB Description: crystal structure of a recombinant anti-single-stranded dna antibody fragment complexed with dt5

SCOP Domain Sequences for d1i8mh2:

Sequence, based on SEQRES records: (download)

>d1i8mh2 b.1.1.2 (H:114-213) Immunoglobulin (constant domains of L and H chains) {Anti ssDNA Fab, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d1i8mh2 b.1.1.2 (H:114-213) Immunoglobulin (constant domains of L and H chains) {Anti ssDNA Fab, (mouse), kappa L chain}
akttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
vtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1i8mh2:

Click to download the PDB-style file with coordinates for d1i8mh2.
(The format of our PDB-style files is described here.)

Timeline for d1i8mh2: