Lineage for d1i8mh1 (1i8m H:1-113)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102005Species Anti ssDNA Fab, (mouse), kappa L chain [69142] (1 PDB entry)
  8. 102008Domain d1i8mh1: 1i8m H:1-113 [66086]
    Other proteins in same PDB: d1i8ma2, d1i8mb2, d1i8mh2, d1i8ml2

Details for d1i8mh1

PDB Entry: 1i8m (more details), 2.1 Å

PDB Description: crystal structure of a recombinant anti-single-stranded dna antibody fragment complexed with dt5

SCOP Domain Sequences for d1i8mh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8mh1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Anti ssDNA Fab, (mouse), kappa L chain}
qvkllesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
nekfkgkatltsdkssstaymelssltsedsavyycvrggyrpyyamdywgqgtsvtvss

SCOP Domain Coordinates for d1i8mh1:

Click to download the PDB-style file with coordinates for d1i8mh1.
(The format of our PDB-style files is described here.)

Timeline for d1i8mh1: