Lineage for d1i8mb2 (1i8m B:114-213)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221069Species Anti-ssDNA Fab, (mouse), kappa L chain [69153] (1 PDB entry)
  8. 221071Domain d1i8mb2: 1i8m B:114-213 [66085]
    Other proteins in same PDB: d1i8ma1, d1i8mb1, d1i8mh1, d1i8ml1
    complexed with so4

Details for d1i8mb2

PDB Entry: 1i8m (more details), 2.1 Å

PDB Description: crystal structure of a recombinant anti-single-stranded dna antibody fragment complexed with dt5

SCOP Domain Sequences for d1i8mb2:

Sequence, based on SEQRES records: (download)

>d1i8mb2 b.1.1.2 (B:114-213) Immunoglobulin (constant domains of L and H chains) {Anti-ssDNA Fab, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d1i8mb2 b.1.1.2 (B:114-213) Immunoglobulin (constant domains of L and H chains) {Anti-ssDNA Fab, (mouse), kappa L chain}
akttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsss
vtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1i8mb2:

Click to download the PDB-style file with coordinates for d1i8mb2.
(The format of our PDB-style files is described here.)

Timeline for d1i8mb2: