Lineage for d1i8mb1 (1i8m B:1-113)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287419Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (118 PDB entries)
  8. 287450Domain d1i8mb1: 1i8m B:1-113 [66084]
    Other proteins in same PDB: d1i8ma1, d1i8ma2, d1i8mb2, d1i8mh2, d1i8ml1, d1i8ml2
    part of anti-ssDNA Fab
    complexed with so4

Details for d1i8mb1

PDB Entry: 1i8m (more details), 2.1 Å

PDB Description: crystal structure of a recombinant anti-single-stranded dna antibody fragment complexed with dt5

SCOP Domain Sequences for d1i8mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8mb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvkllesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
nekfkgkatltsdkssstaymelssltsedsavyycvrggyrpyyamdywgqgtsvtvss

SCOP Domain Coordinates for d1i8mb1:

Click to download the PDB-style file with coordinates for d1i8mb1.
(The format of our PDB-style files is described here.)

Timeline for d1i8mb1: