SCOP 1.65: Domain d1i8mb1: 1i8m B:1-113

Lineage for d1i8mb1 (1i8m B:1-113)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (118 PDB entries)

8. Domain d1i8mb1: 1i8m B:1-113 [66084]
   Other proteins in same PDB: d1i8ma1, d1i8ma2, d1i8mb2, d1i8mh2, d1i8ml1, d1i8ml2
   part of anti-ssDNA Fab
   complexed with so4

Details for d1i8mb1

PDB Entry: 1i8m, 2.1 Å

PDB Description: crystal structure of a recombinant anti-single-stranded dna antibody fragment complexed with dt5

SCOP Domain Sequences for d1i8mb1:

Sequence; same for both SEQRES and ATOM records:

>d1i8mb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvkllesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
nekfkgkatltsdkssstaymelssltsedsavyycvrggyrpyyamdywgqgtsvtvss

Timeline for d1i8mb1:

• d1i8mb1 first appeared in SCOP 1.59
  
• d1i8mb1 appears in SCOP 1.63
  
• d1i8mb1 appears in SCOP 1.67
  
• d1i8mb1 appears in the current release, SCOPe 2.08