Lineage for d1i8mb1 (1i8m B:1-113)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219178Species Anti-ssDNA Fab, (mouse), kappa L chain [69142] (1 PDB entry)
  8. 219180Domain d1i8mb1: 1i8m B:1-113 [66084]
    Other proteins in same PDB: d1i8ma2, d1i8mb2, d1i8mh2, d1i8ml2
    complexed with so4

Details for d1i8mb1

PDB Entry: 1i8m (more details), 2.1 Å

PDB Description: crystal structure of a recombinant anti-single-stranded dna antibody fragment complexed with dt5

SCOP Domain Sequences for d1i8mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8mb1 b.1.1.1 (B:1-113) Immunoglobulin (variable domains of L and H chains) {Anti-ssDNA Fab, (mouse), kappa L chain}
qvkllesgpelvkpgasvkmsckasgytftsyvmhwvkqkpgqglewigyinpyndgtky
nekfkgkatltsdkssstaymelssltsedsavyycvrggyrpyyamdywgqgtsvtvss

SCOP Domain Coordinates for d1i8mb1:

Click to download the PDB-style file with coordinates for d1i8mb1.
(The format of our PDB-style files is described here.)

Timeline for d1i8mb1: