SCOP 1.63: Domain d1i89b2: 1i89 B:236-389

Lineage for d1i89b2 (1i89 B:236-389)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudodyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strands 1 & 5 are antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (2 families)

5. Family c.95.1.2: Chalcone synthase [53914] (2 proteins)

6. Protein Chalcone synthase [53915] (1 species)

7. Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (14 PDB entries)

8. Domain d1i89b2: 1i89 B:236-389 [66077]
   mutant

Details for d1i89b2

PDB Entry: 1i89, 1.86 Å

PDB Description: chalcone synthase (g256l)

SCOP Domain Sequences for d1i89b2:

Sequence; same for both SEQRES and ATOM records:

>d1i89b2 c.95.1.2 (B:236-389) Chalcone synthase {Alfalfa (Medicago sativa)}
ifemvwtaqtiapdsegaidlhlreagltfhllkdvpgivsknitkalveafeplgisdy
nsifwiahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstq
nglkttgeglewgvlfgfgpgltietvvlrsvai

Timeline for d1i89b2:

• d1i89b2 first appeared in SCOP 1.59
  
• d1i89b2 appears in SCOP 1.61
  
• d1i89b2 appears in SCOP 1.65
  
• d1i89b2 appears in the current release, SCOPe 2.08