Lineage for d1i89b2 (1i89 B:236-389)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 186537Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. 186538Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 186670Family c.95.1.2: Chalcone synthase [53914] (2 proteins)
  6. 186671Protein Chalcone synthase [53915] (1 species)
  7. 186672Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (14 PDB entries)
  8. 186696Domain d1i89b2: 1i89 B:236-389 [66077]

Details for d1i89b2

PDB Entry: 1i89 (more details), 1.86 Å

PDB Description: chalcone synthase (g256l)

SCOP Domain Sequences for d1i89b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i89b2 c.95.1.2 (B:236-389) Chalcone synthase {Alfalfa (Medicago sativa)}
ifemvwtaqtiapdsegaidlhlreagltfhllkdvpgivsknitkalveafeplgisdy
nsifwiahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstq
nglkttgeglewgvlfgfgpgltietvvlrsvai

SCOP Domain Coordinates for d1i89b2:

Click to download the PDB-style file with coordinates for d1i89b2.
(The format of our PDB-style files is described here.)

Timeline for d1i89b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i89b1