Lineage for d1i89b1 (1i89 B:2-235)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 128395Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. 128396Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 128524Family c.95.1.2: Chalcone synthase [53914] (2 proteins)
  6. 128525Protein Chalcone synthase [53915] (1 species)
  7. 128526Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (13 PDB entries)
  8. 128547Domain d1i89b1: 1i89 B:2-235 [66076]

Details for d1i89b1

PDB Entry: 1i89 (more details), 1.86 Å

PDB Description: chalcone synthase (g256l)

SCOP Domain Sequences for d1i89b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i89b1 c.95.1.2 (B:2-235) Chalcone synthase {Alfalfa (Medicago sativa)}
vsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmcd
ksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqpk
skithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgafaggtvlrlakdlaenn
kgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekp

SCOP Domain Coordinates for d1i89b1:

Click to download the PDB-style file with coordinates for d1i89b1.
(The format of our PDB-style files is described here.)

Timeline for d1i89b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1i89b2