SCOPe 2.05: Domain d1i89a2: 1i89 A:236-389

Lineage for d1i89a2 (1i89 A:236-389)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.2: Chalcone synthase-like [53914] (9 proteins)

6. Protein Chalcone synthase [53915] (1 species)

7. Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (16 PDB entries)
   Uniprot P30074

8. Domain d1i89a2: 1i89 A:236-389 [66075]

Details for d1i89a2

PDB Entry: 1i89, 1.86 Å

PDB Description: chalcone synthase (g256l)

PDB Compounds: (A:) Chalcone synthase 2

SCOPe Domain Sequences for d1i89a2:

Sequence; same for both SEQRES and ATOM records:

>d1i89a2 c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]}
ifemvwtaqtiapdsegaidlhlreagltfhllkdvpgivsknitkalveafeplgisdy
nsifwiahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstq
nglkttgeglewgvlfgfgpgltietvvlrsvai

Timeline for d1i89a2:

• d1i89a2 first appeared in SCOP 1.59
  
• d1i89a2 appears in SCOPe 2.04
  
• d1i89a2 appears in SCOPe 2.06
  
• d1i89a2 appears in the current release, SCOPe 2.08