![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (2 families) ![]() |
![]() | Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins) |
![]() | Protein Chalcone synthase [53915] (1 species) |
![]() | Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (16 PDB entries) |
![]() | Domain d1i88b1: 1i88 B:1-235 [66072] |
PDB Entry: 1i88 (more details), 1.45 Å
SCOP Domain Sequences for d1i88b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i88b1 c.95.1.2 (B:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} mvsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmc dksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqp kskithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgcfaggtvlrlakdlaen nkgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekp
Timeline for d1i88b1: