![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein beta2-microglobulin [88600] (7 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88602] (475 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
![]() | Domain d1i7ub2: 1i7u B:1-99 [66064] Other proteins in same PDB: d1i7ua1, d1i7ua2, d1i7ub3, d1i7ud1, d1i7ud2, d1i7ue3 |
PDB Entry: 1i7u (more details), 1.8 Å
SCOPe Domain Sequences for d1i7ub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7ub2 b.1.1.2 (B:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1i7ub2: