SCOP 1.61: Domain d1i7ta2: 1i7t A:1-181

Lineage for d1i7ta2 (1i7t A:1-181)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)

6. Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (27 PDB entries)

8. Domain d1i7ta2: 1i7t A:1-181 [66057]
   Other proteins in same PDB: d1i7ta1, d1i7tb1, d1i7td1, d1i7te1

Details for d1i7ta2

PDB Entry: 1i7t, 2.8 Å

PDB Description: crystal structure of class i mhc a2 in complex with peptide p1049-5v

SCOP Domain Sequences for d1i7ta2:

Sequence; same for both SEQRES and ATOM records:

>d1i7ta2 d.19.1.1 (A:1-181) MHC class I, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d1i7ta2:

• d1i7ta2 first appeared in SCOP 1.59
  
• d1i7ta2 appears in SCOP 1.63
  
• d1i7ta2 appears in the current release, SCOPe 2.08