SCOP 1.73: Domain d1i7rd1: 1i7r D:182-275

Lineage for d1i7rd1 (1i7r D:182-275)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)

8. Domain d1i7rd1: 1i7r D:182-275 [66053]
   Other proteins in same PDB: d1i7ra2, d1i7rb_, d1i7rd2, d1i7re_

Details for d1i7rd1

PDB Entry: 1i7r, 2.2 Å

PDB Description: crystal structure of class i mhc a2 in complex with peptide p1058

PDB Compounds: (D:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOP Domain Sequences for d1i7rd1:

Sequence; same for both SEQRES and ATOM records:

>d1i7rd1 b.1.1.2 (D:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d1i7rd1:

• d1i7rd1 first appeared in SCOP 1.59
  
• d1i7rd1 appears in SCOP 1.71
  
• d1i7rd1 appears in SCOP 1.75
  
• d1i7rd1 appears in the current release, SCOPe 2.08